Best Gemini prompts for Biochemists and Biophysicists

Given a newly sequenced protein with the following amino acid sequence: MGKFLLVLAPGFDSKTVLGGTLTLISGLALSLLLTVMALAFGGFWRNDTAEVGDQSLVAIYHQYDPGALAAPEQLLRQQVWLDGAHRAEVSDMSVLVNQLRQQEWFDENLRTVTLHGQVAVLYGQATAMQMNRDLRDAETIQMVQALQQAGAVWSHQPSLRRQLEQAETELRAEVANFALSHYQASLLDNRGCLQAAQRLRGLEAAVRGWRHQGQDVLVMGSDDPDELQALAQVVQAMQQQDAEQRQAAELRAEQAKLREVQEAMELQQTVAQAMQEQVAQAMQQQVAQALQRAQVMELRRQLEQAAE, predict its 3D structure using a combination of homology modeling and ab initio methods. Validate the predicted structure by comparing it to known structures in the Protein Data Bank and evaluate its stability using molecular dynamics simulations. Provide a detailed report on the predicted structure, including its secondary and tertiary elements, as well as any potential binding sites or functional residues.

Analyze the gene expression data from a recent RNA-seq experiment, which consists of 10 samples from two different conditions (5 replicates each). Perform differential gene expression analysis using DESeq2 and identify the top 100 genes with significant changes in expression between the two conditions. Then, use the ReactomePA package to perform pathway enrichment analysis on the differentially expressed genes and identify the top 5 enriched pathways. Visualize the results using a volcano plot and a bar chart, and provide a detailed report on the biological significance of the findings.

Perform molecular docking and virtual screening of a small molecule library against a target protein with the PDB ID 1ATP. Prepare the protein structure by adding hydrogens, assigning charges, and defining the binding site. Then, use AutoDock Vina to dock the small molecules to the target protein and evaluate their binding affinities. Select the top 10 compounds with the highest binding affinities and analyze their chemical properties using RDKit. Provide a detailed report on the docking results, including the binding modes and energies of the top compounds, as well as their potential for further optimization.

Analyze the ChIP-seq data from a recent experiment, which consists of 2 replicates for the treatment condition and 2 replicates for the control condition. Perform quality control checks on the raw sequencing data using FastQC and trim the adapters using Trimmomatic. Then, align the reads to the reference genome using Bowtie2 and call peaks using MACS2. Identify the differentially enriched regions between the treatment and control conditions and visualize the results using a heatmap and a genome browser track. Provide a detailed report on the biological significance of the findings, including the identification of potential transcription factor binding sites and the analysis of the enriched regions using tools such as HOMER and MEME.