Professional Context
The vast amount of data generated in biochemistry and biophysics laboratories can be overwhelming, making it challenging for researchers to extract meaningful insights and make informed decisions. With the rise of advanced data analysis tools, biochemists and biophysicists are now expected to be proficient in not only experimental design and data collection but also in data interpretation and visualization.
💡 Expert Advice & Considerations
Don't rely solely on automated pipelines for data analysis; instead, use them as a starting point and manually curate the results to ensure accuracy and relevance to your research question.

Recommended hardware for AI workflows
Apple MacBook Pro 14-inch (M4 Pro)
Fast, quiet, and long-lasting — a workhorse for heavy multitasking and local AI.
As an Amazon Associate, ProfessionPrompts earns from qualifying purchases.
Advanced Prompt Library
4 Expert PromptsProtein Structure Prediction and Validation
Given a newly sequenced protein with the following amino acid sequence: MGKFLLVLAPGFDSKTVLGGTLTLISGLALSLLLTVMALAFGGFWRNDTAEVGDQSLVAIYHQYDPGALAAPEQLLRQQVWLDGAHRAEVSDMSVLVNQLRQQEWFDENLRTVTLHGQVAVLYGQATAMQMNRDLRDAETIQMVQALQQAGAVWSHQPSLRRQLEQAETELRAEVANFALSHYQASLLDNRGCLQAAQRLRGLEAAVRGWRHQGQDVLVMGSDDPDELQALAQVVQAMQQQDAEQRQAAELRAEQAKLREVQEAMELQQTVAQAMQEQVAQAMQQQVAQALQRAQVMELRRQLEQAAE, predict its 3D structure using a combination of homology modeling and ab initio methods. Validate the predicted structure by comparing it to known structures in the Protein Data Bank and evaluate its stability using molecular dynamics simulations. Provide a detailed report on the predicted structure, including its secondary and tertiary elements, as well as any potential binding sites or functional residues.
Gene Expression Analysis and Pathway Enrichment
Analyze the gene expression data from a recent RNA-seq experiment, which consists of 10 samples from two different conditions (5 replicates each). Perform differential gene expression analysis using DESeq2 and identify the top 100 genes with significant changes in expression between the two conditions. Then, use the ReactomePA package to perform pathway enrichment analysis on the differentially expressed genes and identify the top 5 enriched pathways. Visualize the results using a volcano plot and a bar chart, and provide a detailed report on the biological significance of the findings.
Molecular Docking and Virtual Screening
Perform molecular docking and virtual screening of a small molecule library against a target protein with the PDB ID 1ATP. Prepare the protein structure by adding hydrogens, assigning charges, and defining the binding site. Then, use AutoDock Vina to dock the small molecules to the target protein and evaluate their binding affinities. Select the top 10 compounds with the highest binding affinities and analyze their chemical properties using RDKit. Provide a detailed report on the docking results, including the binding modes and energies of the top compounds, as well as their potential for further optimization.
Chromatin Immunoprecipitation Sequencing (ChIP-seq) Data Analysis
Analyze the ChIP-seq data from a recent experiment, which consists of 2 replicates for the treatment condition and 2 replicates for the control condition. Perform quality control checks on the raw sequencing data using FastQC and trim the adapters using Trimmomatic. Then, align the reads to the reference genome using Bowtie2 and call peaks using MACS2. Identify the differentially enriched regions between the treatment and control conditions and visualize the results using a heatmap and a genome browser track. Provide a detailed report on the biological significance of the findings, including the identification of potential transcription factor binding sites and the analysis of the enriched regions using tools such as HOMER and MEME.
Alternative AI Workflows
Discover how different language models approach tasks for this specific profession.
ChatGPT Prompts for Biochemists and Biophysicists
Explore ChatGPT-optimized templates
Claude Prompts for Biochemists and Biophysicists
Explore Claude-optimized templates
Perplexity Prompts for Biochemists and Biophysicists
Explore Perplexity-optimized templates
Jasper Prompts for Biochemists and Biophysicists
Explore Jasper-optimized templates
Grok Prompts for Biochemists and Biophysicists
Explore Grok-optimized templates
Frequently Asked Questions
What are the best Gemini prompts for Biochemists and Biophysicists?+
The vast amount of data generated in biochemistry and biophysics laboratories can be overwhelming, making it challenging for researchers to extract meaningful insights and make informed decisions. With the rise of advanced data analysis tools, biochemists and biophysicists are now expected to be proficient in not only experimental design and data collection but also in data interpretation and visualization. This page provides 4 expert, copy-paste Gemini prompts crafted specifically for Biochemists and Biophysicists, each with a clear use case and customization notes.
What tasks do these Gemini prompts help Biochemists and Biophysicists with?+
They cover tasks such as Protein Structure Prediction and Validation, Gene Expression Analysis and Pathway Enrichment, Molecular Docking and Virtual Screening, Chromatin Immunoprecipitation Sequencing (ChIP-seq) Data Analysis.
What should Biochemists and Biophysicists keep in mind when using Gemini?+
Don't rely solely on automated pipelines for data analysis; instead, use them as a starting point and manually curate the results to ensure accuracy and relevance to your research question.
How many Gemini prompts are included, and are they free?+
There are 4 ready-to-use Gemini prompts on this page. They are free to copy and use, and you can adapt each one to your specific situation.
Biochemists and Biophysicists
DashboardWorkflows
5