Best Claude prompts for Biochemists and Biophysicists

Given a newly sequenced protein with the following amino acid sequence: MGKFLLVLVLVFAIVFYIRNQEVTGYDPQNVLITGDSIKIAQDLGKEAVVKYVESAFGHPLLDPSKTRGLIQPGQQNIREKKIAEISGVKDEYRVFSPNLLRLLEKDPNAPVRVSYGVRKFDDVTYNNGLLLDVVEQMILAAKRKKNQRRSADTLKPVQYGYEARQYRRMPQYRLGKPVDDTLTRYARVAAELAKRQGKLKLPASRKGTLPGEDRVLVHINGYRPLRLVKAGRIPEEVLQGVLYSQNYGDGTPATMSQYRQVLYGQGSPAAVQAVGLFRGDPASRRRVLARLKRRYVRGGV, predict its three-dimensional structure using a combination of homology modeling, threading, and ab initio prediction methods, and analyze the resulting structure to identify potential binding sites, active sites, and regions of high flexibility, considering the presence of any disulfide bonds, glycosylation sites, or other post-translational modifications that may affect the protein's function and interactions.

Combine data from three separate microarray experiments studying the effects of a specific environmental toxin on gene expression in human liver cells, using a mixed-effects model to account for the variation between experiments, and perform a statistical analysis to identify genes that are differentially expressed across all three experiments, considering the potential impact of batch effects, sample processing, and other sources of technical variation, and provide a list of the top 20 genes with the most significant changes in expression, including their corresponding p-values, fold changes, and functional annotations.

Given a set of experimental data including size exclusion chromatography, dynamic light scattering, and circular dichroism spectroscopy, characterize the biophysical properties of a membrane protein, including its oligomeric state, hydrodynamic radius, and secondary structure, and use this information to predict its potential interactions with other proteins or lipids in the membrane, considering the effects of detergent solubilization, lipid composition, and other environmental factors on the protein's structure and function, and provide a detailed analysis of the protein's stability and potential for aggregation or misfolding.

Construct a network model of the glycolytic pathway in E. coli, including all the major enzymes, metabolites, and regulatory interactions, and use this model to simulate the effects of knocking out or overexpressing specific genes on the pathway's overall flux and productivity, considering the potential impact of feedback inhibition, allosteric regulation, and other nonlinear effects, and identify the key nodes and edges in the network that are most critical for maintaining the pathway's function and robustness, and provide a list of the top 5 genes that are most sensitive to perturbations in the network, including their corresponding flux control coefficients and metabolic flux rates.